Magic™ Goatpox Virus (Pellor) GTPV_gp101 Recombinant Protein(MPYF-1122-KX577)
This product is a made-to-order Goatpox Virus (Pellor) GTPV_gp101 recombinant protein. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.
Product Specifications
Target Protein
GTPV_gp101
Sequence
MDIMGMISNYFSTALIGGIILLAASCIFAFVDFSKHKNNNGITVWRALSGIAFVLGIVMTIGMLIYSAWGKYCSPNKVLIDGGRYNSSAIELNGQ
Product Description
Expression Systems
Based on specific requirements
Protein Tag
Based on specific requirements
Protein Length
Full length
Storage
Aliquot and store at -20°C or lower. For long term storage, we recommend to store at -70°C or lower. Avoid freeze/thaw cycles.
Target
Target Protein
GTPV_gp101
Full Name
IMV membrane protein
Alternative Names
GTPV_gp101; IMV membrane protein; The poxviridae are enveloped unsegmented dsDNA viruses; unlike many dsDNA viruses that replicate in the host nucleus poxviruses encode their own replication machinery and therefore replicate in the cytoplasm; viral genes are expressed in a bi-phasic manner with early genes encoding non-structural proteins involved in genome replication and late genes encoding the viral structural proteins