Magic™ Bovine Papular Stomatitis Virus (BV-AR02) BPSVgORF117 Recombinant Protein(MPYF-1022-KX207)
This product is a made-to-order Bovine Papular Stomatitis Virus (BV-AR02) BPSVgORF117 recombinant protein. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.
Product Specifications
Target Protein
BPSVgORF117
Species
Bovine Papular Stomatitis Virus
Sequence
MWLPRALLALSVICGTASSYRGMHDGGEFCRAHSREIFTSFQMWMRIQRNVQTARNATQCALDVEAPPDMFDVVAYANTAGIAVTVATANVGRVDVRTLQVLYSTNKSSMFVYLDTWSPWTKYTRPLYSNASADAHNETIDCLLEVLDLNKVHVDVGCAVEDIPVDVVDPIDYPRVYDPDLLRYVIPKNRKQNPGYVFVDLSVDSYCVHSVNVKTVLRDACIHHKNETPLNFYGRENFPLHKSPNSVIPTHKRGFSTCEMITGQ
Product Description
Expression Systems
Based on specific requirements
Protein Tag
Based on specific requirements
Protein Length
Full length
Storage
Aliquot and store at -20°C or lower. For long term storage, we recommend to store at -70°C or lower. Avoid freeze/thaw cycles.
Target
Target Protein
BPSVgORF117
Full Name
GM-CSF/IL-2 inhibition factor
Alternative Names
BPSVgORF117; GM-CSF/IL-2 inhibition factor; immune evasion; enhances viral replication; similar to vaccinia strain Copenhagen A41L; Viruses of the genus parapoxvirus cause localized diseases in large and small ruminants; the poxviridae are enveloped unsegmented dsDNA viruses; unlike many dsDNA viruses that replicate in the host nucleus poxviruses encode their own replication machinery and therefore replicate in the cytoplasm; viral genes are expressed in a bi-phasic manner with early genes genes encoding non-structural proteins involved in genome replication and late genes encoding the viral structural proteins; Orf virus and BPSV are capable of infecting humans but usually infect sheep, goats and cattle
Datasheet