Magic™ Yaba Monkey Tumor Virus (VR587) YMTVg76R Recombinant Protein(MPYF-1122-KX354)
This product is a made-to-order Yaba Monkey Tumor Virus (VR587) YMTVg76R recombinant protein. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.
Product Specifications
Species
Yaba Monkey Tumor Virus
Sequence
MSWSINLGNGGDNFKTLDEIRAHVKSTTESVDEVTEEIFPSDIEIPSQKTPIKKRAVTRKKQTTVSKPKCSGKEKLIKPESDNEKTEENEKSKENLSKNTNSDEDINDSDLKIATDKIIKDLKVLNSRISAISTVLEDVQASSVSRQFTSLGKSVDVLKATIESGKTKVTRKKPRHDLKK
Product Description
Expression Systems
Based on specific requirements
Protein Tag
Based on specific requirements
Protein Length
Full length
Storage
Aliquot and store at -20°C or lower. For long term storage, we recommend to store at -70°C or lower. Avoid freeze/thaw cycles.
Target
Full Name
late transcription factor VLTF-4
Alternative Names
YMTVg76R; late transcription factor VLTF-4; initiates transcription from late gene promoters; inhibition of DNA replication causes VLTF-4 to be diffusely distributed in the cytoplasm but is discretely localized during a productive infection; The poxviridae are enveloped unsegmented dsDNA viruses; unlike many dsDNA viruses that replicate in the host nucleus poxviruses encode their own replication machinery and therefore replicate in the cytoplasm; viral genes are expressed in a bi-phasic manner with early genes encoding non-structural proteins involved in genome replication and late genes encoding the viral structural proteins
Datasheet