Magic™ Yaba Monkey Tumor Virus (VR587) YMTVg19L Recombinant Protein(MPYF-1122-KX314)
This product is a made-to-order Yaba Monkey Tumor Virus (VR587) YMTVg19L recombinant protein. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.
Product Specifications
Species
Yaba Monkey Tumor Virus
Sequence
MESETFIDVLHVEKLSTFLKQPLPSDEKMVVIIAVGGIIRVSKNVLDMLSEYFKNLDCDKLREHTIIVNFNVDAFKEVVNYANTGHITVNYNNVTNILAIASKFSLIFVKNVCVDFMTKIISEDNCVHFLRIGFNYECYRLYGEAVDFIRNNFETLAMFEKLLKLSYNELKLMLISDELNVSSEDVVLKFLIRWSLYKDNQRRAHILAQEVLRTTHLSVNGLHRLKRWFTKIGKSKLVFRNIPPRRMYSEHNNLSNEILDSLEHGMFNLSYLKNVDMWKKINNMINIHHVCCGSIVINNLIFLIGGMDINNTCVRKVVGFDTSTSSLFKVPDMIYPRKFPGVVNFNNRVYVIGGVYDVNLNAVESWFPGERVWRDEKSLIMPRYSPCAEVVNDNILFVFGGVSEYDRTVECLSLFTNEWKLCSMSRYSHFGGCTAFYDGNIYLIGGLSHVNDVEEYKVVEIYNPYIDQWNMGPPINVPRLNASVCNFNNLILVVGGYFNDSYVKDVEMFCGNRWEVIGQLDIIS
Product Description
Expression Systems
Based on specific requirements
Protein Tag
Based on specific requirements
Protein Length
Full length
Storage
Aliquot and store at -20°C or lower. For long term storage, we recommend to store at -70°C or lower. Avoid freeze/thaw cycles.
Target
Full Name
kelch-like protein
Alternative Names
YMTVg19L; Kelch-like protein; Kelch motifs are 50-amino acid motifs represented by one beta-sheet blade; may be involved in remodelling and stabilization of the host cytoskeleton and host immune evasion; BTB-Kelch proteins have Kelch repeats that can interact with actin filaments; the poxviridae are enveloped unsegmented dsDNA viruses; unlike many dsDNA viruses that replicate in the host nucleus poxviruses encode their own replication machinery and therefore replicate in the cytoplasm; viral genes are expressed in a bi-phasic manner with early genes genes encoding non-structural proteins involved in genome replication and late genes encoding the viral structural proteins
Datasheet