Magic™ Yaba Monkey Tumor Virus (VR587) YMTVg144R Recombinant Protein(MPYF-1122-KX276)

This product is a made-to-order Yaba Monkey Tumor Virus (VR587) YMTVg144R recombinant protein. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications
Target Protein
YMTVg144R
Species
Yaba Monkey Tumor Virus
Strain
VR587
Protein Class
Virology
Sequence
MNINMIKLIIILSVFSKTCAVCTFNKKDAEYSNVISYEDRTYKDNEKLNYECAYGFNSVFVICNNGSWSTKNMCIGKRNCKDPVMILNGNIKNKQDKYSLGDSVTYMCKVNKLERYSLVGNETVKCIDGKWVPDNPFCKLIRCKYPALQNGILEGSFKKKFYYGDVVIFKCKTGFRLSGSLTSTCGINFVWVPNLPKCVKDSVVHDEVRSDYLFKYLNDSNNDYDTNYYMQNIVAVIFLVIICFIFVLGLSILSCSFASTSKPSYDKL
Product Description
Expression Systems
Based on specific requirements
Protein Tag
Based on specific requirements
Protein Length
Full length
Protein Form
Soluble
Storage
Aliquot and store at -20°C or lower. For long term storage, we recommend to store at -70°C or lower. Avoid freeze/thaw cycles.
Target
Target Protein
YMTVg144R
Full Name
EEV host range protein
Alternative Names
YMTVg144R; EEV host range protein; similar to deerpox virus 156 and lumpy skin disease virus 141; contains a complement control module which is found in a wide variety of complement and adhesion proteins; The poxviridae are enveloped unsegmented dsDNA viruses; unlike many dsDNA viruses that replicate in the host nucleus poxviruses encode their own replication machinery and therefore replicate in the cytoplasm; viral genes are expressed in a bi-phasic manner with early genes encoding non-structural proteins involved in genome replication and late genes encoding the viral structural proteins; Members of the genus Yatapoxvirus, which include Tanapox virus (TPV) and Yaba monkey tumor virus, infect primates including humans
Gene ID
UniProt ID

Related Products

We DO NOT PROVIDE ANY PRODUCTS OR SERVICES DIRECTLY TO PATIENTS. All of our products are for Research Use Only (RUO), NOT intended for diagnostic, therapeutic, or clinical use.