Online Inquiry
We DO NOT PROVIDE ANY PRODUCTS OR SERVICES DIRECTLY TO PATIENTS. All of our products are for Research Use Only (RUO), NOT intended for diagnostic, therapeutic, or clinical use.
Magic™ Tanapox, Yaba-like Disease Virus () 76R Recombinant Protein(MPYF-1122-KX236)
DatasheetThis product is a made-to-order Tanapox, Yaba-like Disease Virus () 76R recombinant protein. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.
Product Specifications
Target Protein
76R
Species
Tanapox, Yaba-like Disease Virus
Protein Class
Virology
Sequence
MSWSINLGNGGDNFKTLDEIRAHVKSTTESVEEVTEEIFPDDIEIPSQKTPTKKKTTSRKKQTVQKPKCVGKEKNVKHESDDDKTEENEKSKESLSKNNDSNEEDIETSDLKIATDQIVKDLKIINSRINAIHTVLEDVQASSISRQFTSLSKSVDGLKAAVESGRIKVVRKKSRQYSKK
Product Description
Expression Systems
Based on specific requirements
Protein Tag
Based on specific requirements
Protein Length
Full length
Protein Form
Soluble
Storage
Aliquot and store at -20°C or lower. For long term storage, we recommend to store at -70°C or lower. Avoid freeze/thaw cycles.
Related Products
We DO NOT PROVIDE ANY PRODUCTS OR SERVICES DIRECTLY TO PATIENTS. All of our products are for Research Use Only (RUO), NOT intended for diagnostic, therapeutic, or clinical use.