Magic™ Squirrel Parapoxvirus (Red squirrel UK) SQPV_0640 Recombinant Protein(MPYF-1022-KX784)
This product is a made-to-order Squirrel Parapoxvirus (Red squirrel UK) SQPV_0640 recombinant protein. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.
Product Specifications
Species
Squirrel Parapoxvirus
Sequence
MEKAWCVLVALLAVAGCANAGILETKCTYTRHRLPGQQGHMLCEISFNEFVILREKGNVMSRYREEPGSSWVNVSDPTFQHLSVSLSTIKADLIETSDLLFPKYYHDDISEHFGCVLNWENNYGFDVFSISMPGYKPAEMVFFDKDKRDYVVPGGQPAAGVWDKDWHGHRRHKGIMARYLKFRCEALFTWLDKLSRKHQDKVRQPAGPKKVEVKLFDKPEKDMIRMKCSADGYFARDVLLAWFNGTREMETMFPTYPTPDNVAKFYHAKWDSATKFYGHASTVSPAIHKNEADCVKCMVVAGYNSHHKYMCSDCERPEHHPPCPGERDPYAETW
Product Description
Expression Systems
Based on specific requirements
Protein Tag
Based on specific requirements
Protein Length
Full length
Storage
Aliquot and store at -20°C or lower. For long term storage, we recommend to store at -70°C or lower. Avoid freeze/thaw cycles.
Target
Full Name
major histocompatibility complex-like class I (lizard)
Alternative Names
SQPV_0640; major histocompatibility complex-like class I (lizard)