Magic™ Lumpy Skin Disease Virus (Neethling 2490) LSDV155 Recombinant Protein(MPYF-1122-KX820)

This product is a made-to-order Lumpy Skin Disease Virus (Neethling 2490) LSDV155 recombinant protein. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications
Target Protein
LSDV155
Species
Lumpy Skin Disease Virus
Strain
Neethling 2490
Protein Class
Virology
Sequence
MLCIFYIARLCNLIIYSLYSLLMFPMQKLISFMFGNLNPFDSVLDKDEKIQDNINTNHKPIESKEINNDLPLTVLDKKDTSDINIRNDNGVFDFIKIPNPFKKHYEYYCNQNTIKEPPRKGLVERMMNMVE
Product Description
Expression Systems
Based on specific requirements
Protein Tag
Based on specific requirements
Protein Length
Full length
Protein Form
Soluble
Storage
Aliquot and store at -20°C or lower. For long term storage, we recommend to store at -70°C or lower. Avoid freeze/thaw cycles.
Target
Target Protein
LSDV155
Full Name
Hypothetical protein
Alternative Names
LSDV155; hypothetical protein; The poxviridae are enveloped unsegmented dsDNA viruses; unlike many dsDNA viruses that replicate in the host nucleus poxviruses encode their own replication machinery and therefore replicate in the cytoplasm; viral genes are expressed in a bi-phasic manner with early genes encoding non-structural proteins involved in genome replication and late genes encoding the viral structural proteins; the Entomopoxvirinae are a sub-family of the Poxviridae that infect insects
Gene ID
UniProt ID

Related Products

We DO NOT PROVIDE ANY PRODUCTS OR SERVICES DIRECTLY TO PATIENTS. All of our products are for Research Use Only (RUO), NOT intended for diagnostic, therapeutic, or clinical use.