Magic™ Lumpy Skin Disease Virus (Neethling 2490) LSDV135 Recombinant Protein(MPYF-1122-KX754)
This product is a made-to-order Lumpy Skin Disease Virus (Neethling 2490) LSDV135 recombinant protein. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.
Product Specifications
Species
Lumpy Skin Disease Virus
Sequence
MLLLTSFVFSLLFSHSLGKRNLSYFDTDEYKNSIKDVYDFSKRLLDDDVLFALNDNCTFRDERGTLATLKEPLSLKCPLLNEYGLKWPYMEKDDYEIKWEVVRNYTKKSINNNTNNYLIEDGKLLILKANLNTLNSKYLCTITRKRDNDCDQSIVRLSRYRNKNCYKLNGLKGRNIVIECGVRHVEYDTVEWYKQNKTSIIKLNNDSKRRIIIRNITKGDSGKYYCKGHYSKLNISYTISRCTYLSVFSLSHYEYELVYMPTIINVTIGEPMTVNCSVRTKANAYEYIGAMWLDDKKLYVGMEENLYQDGSRKIEGDDIIKTSHLVFVNVMEKDIGRTFTCEVGSRFKGEYRTVTLNLKS
Product Description
Expression Systems
Based on specific requirements
Protein Tag
Based on specific requirements
Protein Length
Full length
Storage
Aliquot and store at -20°C or lower. For long term storage, we recommend to store at -70°C or lower. Avoid freeze/thaw cycles.
Target
Full Name
LSDV135 putative IFN-alpha/beta binding protein
Alternative Names
LSDV135; LSDV135 putative IFN-alpha/beta binding protein