Magic™ Goatpox Virus (Pellor) GTPV_gp134 Recombinant Protein(MPYF-1122-KX615)
This product is a made-to-order Goatpox Virus (Pellor) GTPV_gp134 recombinant protein. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.
Product Specifications
Target Protein
GTPV_gp134
Sequence
MKNIHMLLILLCNKVYSLCDLNKCCYPPSIKNGYIYNKKTEYNIGSNVTFFCGNNTRGVRYTLVGEKNIICEKDGKWNKKFPVCKIIRCRFPALQNGFVNGIPDSRKFYYESEVSFSCKPGFVLIGTKYSVCGINSSWIPKVPVCSRDNITYNKIYINKVNIDDNFFNQINNSNTYYFDKILQINNVNRYTLIFFVVVSIKILFGFVFIFFSFNKKPLDSIKYYK
Product Description
Expression Systems
Based on specific requirements
Protein Tag
Based on specific requirements
Protein Length
Full length
Storage
Aliquot and store at -20°C or lower. For long term storage, we recommend to store at -70°C or lower. Avoid freeze/thaw cycles.
Target
Target Protein
GTPV_gp134
Full Name
EEV Host range protein
Alternative Names
GTPV_gp134; EEV host range protein; glycoprotein that is present on the surfaces of infected cells and virus particles; is not required for viral replication in tissue culture; similar to vaccinia virus strain Copenhagen C3L; contains a complement control module which is found in a wide variety of complement and adhesion proteins; The poxviridae are enveloped unsegmented dsDNA viruses; unlike many dsDNA viruses that replicate in the host nucleus poxviruses encode their own replication machinery and therefore replicate in the cytoplasm; viral genes are expressed in a bi-phasic manner with early genes genes encoding non-structural proteins involved in genome replication and late genes encoding the viral structural proteins
Datasheet