Magic™ Canarypox Virus (VR-111) CNPV251 Recombinant Protein(MPYF-1222-KX600)
This product is a made-to-order Canarypox Virus (VR-111) CNPV251 recombinant protein. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.
Product Specifications
Sequence
MAVDTFVILAVIVVIVCLLIYAAYRRYKGIPPRNTEERFGDYLEKDPLFKDSLTPDQIRALHRLVSLSV
Product Description
Expression Systems
Based on specific requirements
Protein Tag
Based on specific requirements
Protein Length
Full length
Storage
Aliquot and store at -20°C or lower. For long term storage, we recommend to store at -70°C or lower. Avoid freeze/thaw cycles.
Target
Full Name
putative IMV membrane protein
Alternative Names
CNPV251; putative IMV membrane protein; similar to vaccinia virus A13L; unlike many dsDNA viruses that replicate in the host nucleus poxviruses encode their own replication machinery and therefore replicate in the cytoplasm; viral genes are expressed in a bi-phasic manner with early genes encoding non-structural proteins involved in genome replication and late genes encoding the viral structural proteins; canarypox and fowlpox are members of the Avipoxvirus genus and infect nonmammalian hosts; Fowlpox virus infects chickens and turkeys while Canarypox has a broader host-range and infects passeriform (song) birds
Datasheet