Magic™ Camelpox virus (M-96) CamMLVgp033 Recombinant Protein(MPYF-0722-KX426)
This product is a made-to-order Camelpox virus (M-96) CamMLVgp033 recombinant protein. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.
Product Specifications
Target Protein
CamMLVgp033
Sequence
MNLDNTIAVITETIPIGMQFDKVYLSTFNVWREILSNTTKTLDISSFYWSLSDEVGTNFGTTILNEIVQLPKRGVRVRVAVNKSNKPLKDVETLQMAGVEVRYIDITNILGGVLHTKFWISDNTHIYLGSANMDWRSLTQVKELGIAMFNNRNLAADLTQIFEVYWYLGVNNLPYNWKNFYPAYYNTDHPLSMNVSGVQHSVFIASAPQQLCTMERTNDLTALLSCIRNASKFVYVSVMNFIPIIYSRAGNILFWPYIEDELRRTAIDRKVSVKLLISCWQRSSFIMRNFLRSIAMLKSKNIDIEVKLFIVPDADPPIPYSRVNHAKYMVTDKTAYIGTSNWTGNYFTDTCGTSINITPDDGLGLRQQLEDIFMGDWNSKYSYELYDTSPTKRCRLLKNMKQCTNDIYSDEIQPEKEIPEYSLE
Product Description
Expression Systems
Based on specific requirements
Protein Tag
Based on specific requirements
Protein Length
Full length
Storage
Aliquot and store at -20°C or lower. For long term storage, we recommend to store at -70°C or lower. Avoid freeze/thaw cycles.
Target
Target Protein
CamMLVgp033
Full Name
Phospholipase-D-like protein
Alternative Names
CamMLVgp033; phospholipase-D-like protein; similar to vaccinia virus strain Copenhagen K4L; phospholipase D converts phospholipids into phosphatidic acid, which is thought to be involved in the regulation of lipid movement; modification of lipid movement may enhance viral release and/or trafficking of viral proteins; The poxviridae are enveloped unsegmented dsDNA viruses; unlike many dsDNA viruses that replicate in the host nucleus poxviruses encode their own replication machinery and therefore replicate in the cytoplasm; viral genes are expressed in a bi-phasic manner with early genes genes encoding non-structural proteins involved in genome replication and late genes encoding the viral structural proteins
Datasheet