Magic™ Bovine Papular Stomatitis Virus (BV-AR02) BPSVgORF033 Recombinant Protein(MPYF-1022-KX258)
This product is a made-to-order Bovine Papular Stomatitis Virus (BV-AR02) BPSVgORF033 recombinant protein. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.
Product Specifications
Target Protein
BPSVgORF033
Species
Bovine Papular Stomatitis Virus
Sequence
MNNRDLGTAVGATLLMLVIVVLGGATVLRRGSASLGIRSRGALRVLTVMDFLAMLTTIPCTIILYFLCMQQLWRASGKRTENIHVL
Product Description
Expression Systems
Based on specific requirements
Protein Tag
Based on specific requirements
Protein Length
Full length
Storage
Aliquot and store at -20°C or lower. For long term storage, we recommend to store at -70°C or lower. Avoid freeze/thaw cycles.
Target
Target Protein
BPSVgORF033
Full Name
ORF033 IMV membrane protein
Alternative Names
BPSVgORF033; ORF033 IMV membrane protein; structural protein; Similar to Vaccinia virus strain Copenhagen I5L and Molluscum contagiosum MC047L; Viruses of the genus parapoxvirus cause localized diseases in large and small ruminants; the poxviridae are enveloped unsegmented dsDNA viruses; unlike many dsDNA viruses that replicate in the host nucleus poxviruses encode their own replication machinery and therefore replicate in the cytoplasm; viral genes are expressed in a bi-phasic manner with early genes genes encoding non-structural proteins involved in genome replication and late genes encoding the viral structural proteins; Orf virus and BPSV are capable of infecting humans but usually infect sheep, goats and cattle