Ectromelia virus (Moscow) EVM013 Recombinant Protein(MPYF-0722-KX754)

This product is a made-to-order Ectromelia virus (Moscow) EVM013 recombinant protein. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications
Target Protein
EVM013
Species
Ectromelia virus
Strain
Moscow
Protein Class
Virology
Sequence
MRILFLIAFMYGCVHSYVNAVETKCPNLDIVTSSGEFHCSGCVEHMPEFSYMYWLAKDMKSDEDTKFIEHLGDGINEDETVRTTDGGTTTLRKVLHVTDTNKFAHYRFTCVLTTLDGVSKKEYLAEVAHDTIFIYDII
Product Description
Expression Systems
Based on specific requirements
Protein Tag
Based on specific requirements
Protein Length
Full length
Protein Form
Soluble
Storage
Aliquot and store at -20°C or lower. For long term storage, we recommend to store at -70°C or lower. Avoid freeze/thaw cycles.
Target
Target Protein
EVM013
Full Name
IL-18 binding protein
Alternative Names
ECTVgp013; EVM013; IL-18 binding protein
Gene ID
UniProt ID

Related Products

We DO NOT PROVIDE ANY PRODUCTS OR SERVICES DIRECTLY TO PATIENTS. All of our products are for Research Use Only (RUO), NOT intended for diagnostic, therapeutic, or clinical use.

Inquiry
Now