Sheeppox Virus (TU-V02127) SPPV_135 Recombinant Protein(MPYF-1122-KX537)
This product is a made-to-order Sheeppox Virus (TU-V02127) SPPV_135 recombinant protein. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.
Product Specifications
Sequence
MGNKKNDEIKRIIKEYIRWRGNGEKNICEESELNIFFEKLKKMDSYVKKNIKESNNDEYDIIKSMKLSLDDGPRMDKLPKYLLDGLNAEKILGLCGIISEKVVSETYKVNWDRVYESLFNILDEKKINYIKSKIM
Product Description
Expression Systems
Based on specific requirements
Protein Tag
Based on specific requirements
Protein Length
Full length
Storage
Aliquot and store at -20°C or lower. For long term storage, we recommend to store at -70°C or lower. Avoid freeze/thaw cycles.
Target
Full Name
hypothetical protein
Alternative Names
SPPV_135; putative secreted virulence factor; similar to vaccinia virus strain Copenhagen N1L; The poxviridae are enveloped unsegmented dsDNA viruses; unlike many dsDNA viruses that replicate in the host nucleus poxviruses encode their own replication machinery and therefore replicate in the cytoplasm; viral genes are expressed in a bi-phasic manner with early genes encoding non-structural proteins involved in genome replication and late genes encoding the viral structural proteins; the Entomopoxvirinae are a sub-family of the Poxviridae that infect insects