Myxoma Virus (Lausanne) MYXV_gp166 Recombinant Protein(MPYF-1222-KX164)
This product is a made-to-order Myxoma Virus (Lausanne) MYXV_gp166 recombinant protein. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.
Product Specifications
Target Protein
MYXV_gp166
Sequence
MLCVFYLARLCNLFVYSVYTLLMYPINRLVSFMFGELNPVCEPDPKKDDDRVVVPADCPPIPKEPLNANELNGMFDFMKIPNPFKRYECNNNTKQPSSYPLKKGFFDMMETLE
Product Description
Expression Systems
Based on specific requirements
Protein Tag
Based on specific requirements
Protein Length
Full length
Storage
Aliquot and store at -20°C or lower. For long term storage, we recommend to store at -70°C or lower. Avoid freeze/thaw cycles.
Target
Target Protein
MYXV_gp166
Full Name
Hypothetical protein
Alternative Names
MYXV_gp166; hypothetical protein; The poxviridae are enveloped unsegmented dsDNA viruses; unlike many dsDNA viruses that replicate in the host nucleus poxviruses encode their own replication machinery and therefore replicate in the cytoplasm; viral genes are expressed in a bi-phasic manner with early genes encoding non-structural proteins involved in genome replication and late genes encoding the viral structural proteins; the Entomopoxvirinae are a sub-family of the Poxviridae that infect insects