Magic™ Swinepox (17077-99) SPV109 Recombinant Protein(MPYF-1222-KX17)
This product is a made-to-order Swinepox (17077-99) SPV109 recombinant protein. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.
Product Specifications
Sequence
MTTLDDLNMLKDLLKLKKCLHIADQHTREKYNTLVDQATFKYWKIDIHKIMTSETSINSYYTPSKKSPFMLDAGEYVFLPMCFGNVFIYKGSMMELGSGDIYHIDDNMKSIIDDIIDEYQVDFLRFVYFKRMWILEDCFSTISPIIILKKASEKGLLSVPYLLVRVDDTVMFNDDDYNNLEILFTSKMYNIFKPESICYIKIGTSKRNIIDFFTSSYMYVKGIDLEYLGDNCYIPRIITKNSACILVKDIQHLIRSKIKKNIFVVVHKKKYFSILQTAANYTSNETLSESLCRILKDIGGNKFFINGKYLSKVNNNMGIKHLSIKLGIDPVNTIEDLIKSITRSDDLKKRIKSESIFEIVRECLEYPKSDFITLINNINFDIKNSIVEDFKLENINCLDNPNISAIYGNFNRFVSLFNILIHVKQSLS
Product Description
Expression Systems
Based on specific requirements
Protein Tag
Based on specific requirements
Protein Length
Full length
Storage
Aliquot and store at -20°C or lower. For long term storage, we recommend to store at -70°C or lower. Avoid freeze/thaw cycles.
Target
Full Name
SPV109 DNA polymerase processivity-like factor
Alternative Names
SPV109; SWPVgp110; SPV109 DNA polymerase processivity-like factor