Magic™ Sheeppox Virus (TU-V02127) SPPV_140 Recombinant Protein(MPYF-1122-KX513)

This product is a made-to-order Sheeppox Virus (TU-V02127) SPPV_140 recombinant protein. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications
Target Protein
SPPV_140
Species
Sheeppox Virus
Strain
TU-V02127
Protein Class
Virology
Sequence
MSLLYEYVLNSPTVDKDALELLIRTGFDVNEENCDNESILLLYLKRKDVSIDILKLLLKNGADVNYRSYYDTSITSVIRNHELDSNTIKQIIILLLKFGADINLKPFNSVYTIMPFIYNFHINNCNMFKFLISKGIYVKNDIIDSRGFNLFHMYFESFSVKIDVIKILLSFNVGLFEKSFKGLTPMNIYFNHFIDVISLKVIKYLISKGVNIETNNNGSKSLLETFLRSNKILSKKCFKVLNFILKYVKLNKVDKKGLNPILISAKADNYNAFNHLLKLGDDIYNVSKKGNTVITYAIKRENIDILNRVLSIEPKKYLIKQTFEYFSNYGYGGINGLFLNERKSLMMILLMQYSFKVYPIFYKNFYEVRLLFPNIIEMYNKDILLMEKENVGKNISVYDLVFNREKETIPVKFLKNEKFLKFTSSTIYGERIKQIINNTYKYENCLNTSINILNKYCNKKNYWNYLPTEIKIYILEYLDFSDFDTIMNKKRKSKKYFL
Product Description
Expression Systems
Based on specific requirements
Protein Tag
Based on specific requirements
Protein Length
Full length
Protein Form
Soluble
Concentration
Lot specific
Storage
Aliquot and store at -20°C or lower. For long term storage, we recommend to store at -70°C or lower. Avoid freeze/thaw cycles.
Target
Target Protein
SPPV_140
Full Name
ankyrin repeat protein
Alternative Names
SPPV_140; ankyrin repeat protein; similar to vaccinia virus B4R; although the function of the ankyrin-like proteins are not completely understood, they are highly conserved throughout the Orthopoxvirus genus; Ankyrin repeats are tandemly repeated modules of approximately 33 amino acids; the ankyrin-like protein of the modified vaccinia virus ankara interacts with Skp1a, a member of the Skp1a-Cullin-1-F-box (SCF) ubiquitin ligase complex; the poxviridae are enveloped unsegmented dsDNA viruses; unlike many dsDNA viruses that replicate in the host nucleus poxviruses encode their own replication machinery and therefore replicate in the cytoplasm; viral genes are expressed in a bi-phasic manner with early genes encoding non-structural proteins involved in genome replication and late genes encoding the viral structural proteins
Gene ID
UniProt ID

Related Products

We DO NOT PROVIDE ANY PRODUCTS OR SERVICES DIRECTLY TO PATIENTS. All of our products are for Research Use Only (RUO), NOT intended for diagnostic, therapeutic, or clinical use.