Magic™ Sheeppox Virus (TU-V02127) SPPV_140 Recombinant Protein(MPYF-1122-KX513)
This product is a made-to-order Sheeppox Virus (TU-V02127) SPPV_140 recombinant protein. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.
Product Specifications
Sequence
MSLLYEYVLNSPTVDKDALELLIRTGFDVNEENCDNESILLLYLKRKDVSIDILKLLLKNGADVNYRSYYDTSITSVIRNHELDSNTIKQIIILLLKFGADINLKPFNSVYTIMPFIYNFHINNCNMFKFLISKGIYVKNDIIDSRGFNLFHMYFESFSVKIDVIKILLSFNVGLFEKSFKGLTPMNIYFNHFIDVISLKVIKYLISKGVNIETNNNGSKSLLETFLRSNKILSKKCFKVLNFILKYVKLNKVDKKGLNPILISAKADNYNAFNHLLKLGDDIYNVSKKGNTVITYAIKRENIDILNRVLSIEPKKYLIKQTFEYFSNYGYGGINGLFLNERKSLMMILLMQYSFKVYPIFYKNFYEVRLLFPNIIEMYNKDILLMEKENVGKNISVYDLVFNREKETIPVKFLKNEKFLKFTSSTIYGERIKQIINNTYKYENCLNTSINILNKYCNKKNYWNYLPTEIKIYILEYLDFSDFDTIMNKKRKSKKYFL
Product Description
Expression Systems
Based on specific requirements
Protein Tag
Based on specific requirements
Protein Length
Full length
Storage
Aliquot and store at -20°C or lower. For long term storage, we recommend to store at -70°C or lower. Avoid freeze/thaw cycles.
Target
Full Name
ankyrin repeat protein
Alternative Names
SPPV_140; ankyrin repeat protein; similar to vaccinia virus B4R; although the function of the ankyrin-like proteins are not completely understood, they are highly conserved throughout the Orthopoxvirus genus; Ankyrin repeats are tandemly repeated modules of approximately 33 amino acids; the ankyrin-like protein of the modified vaccinia virus ankara interacts with Skp1a, a member of the Skp1a-Cullin-1-F-box (SCF) ubiquitin ligase complex; the poxviridae are enveloped unsegmented dsDNA viruses; unlike many dsDNA viruses that replicate in the host nucleus poxviruses encode their own replication machinery and therefore replicate in the cytoplasm; viral genes are expressed in a bi-phasic manner with early genes encoding non-structural proteins involved in genome replication and late genes encoding the viral structural proteins
Datasheet