Magic™ Monkeypox virus (Zaire-96-I-16) B14R Recombinant Protein(MPYF-0722-KX278)
This product is a made-to-order Monkeypox virus (Zaire-96-I-16) B14R recombinant protein. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.
Product Specifications
Sequence
MSILPVIFLPIFFYSPFVQTFNVPECIDKGQYFASFMELENEPV
ILPCPQINTLSSGYNILDILWEKRGADNDRIIQIDNGSNMLILNPTQSDSGIYICITT
NETYCDMMSLNLTIVSVSESNIDLISYPQIVNERSTGEMVCPNINAFISSNVNADIIW
SGHRRLRNKRLKQRTPGIITIEDVRKNDAGYYTCVLEYIYMGKTYNVTRIIKLEVRDR
IIPPTMKLPEGVVTSIGSNLTITCRVSLRLPTTDADVFWISNGMYYEEEDEDGDGRIS
VANKIYMTDKRRVITSWLNINPVKEEDATTFTCMAFTIPSISKTVTVSIT
Product Description
Expression Systems
Based on specific requirements
Protein Tag
Based on specific requirements
Protein Length
Full length
Storage
Aliquot and store at -20°C or lower. For long term storage, we recommend to store at -70°C or lower. Avoid freeze/thaw cycles.
Target
Full Name
IL-beta-binding protein
Alternative Names
MPXVgp175; B14R; IL-beta-binding protein; binds to cytokines that participate in the regulation of immune responses (interleukin beta) to mediate host immune evasion; similar to vaccinia virus strain Copenhagen B16R; has ATP-binding domain; transfers the gamma phosphate from ATP to one or more amino acid residues in a protein substrate; the poxviridae are enveloped unsegmented dsDNA viruses; unlike many dsDNA viruses that replicate in the host nucleus poxviruses encode their own replication machinery and therefore replicate in the cytoplasm; viral genes are expressed in a bi-phasic manner with early genes genes encoding non-structural proteins involved in genome replication and late genes encoding the viral structural proteins