Goatpox Virus (Pellor) GTPV_gp008 Recombinant Protein(MPYF-1122-KX574)
                        
                     
                        This product is a made-to-order Goatpox Virus (Pellor) GTPV_gp008 recombinant protein. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.
                    
                    
                            
                                
                                    Product Specifications
                                
                                
                                    
                                        
                                            
                                                            
                                                                
                                                                    
                                                                        Target Protein
                                                                    
                                                                
                                                                GTPV_gp008
                                                             
                                                            
                                                            
                                                            
                                                            
                                                                
                                                                    
                                                                        Sequence
                                                                    
                                                                
                                                                MEGSDNNNTHCWICKDEYNVITNFCNCKNEFKIVHKNCLEEWINFSHDTKCKICNGKYNIKKNKKSCLRWKCSFIYCNVPAICVSLICLLLLTLTILLVKFNLKSMLENIENSDLIALIYVIAYSLPCVVGFITVIHILIALYDYYLAAKSDNITYQVYEYI
                                                             
                                             
                                         
                                     
                                 
                             
                            
                                
                                    Product Description
                                
                                
                                    
                                        
                                            
                                                            
                                                                
                                                                    
                                                                        Expression Systems
                                                                    
                                                                
                                                                Based on specific requirements
                                                             
                                                            
                                                                
                                                                    
                                                                        Protein Tag
                                                                    
                                                                
                                                                Based on specific requirements
                                                             
                                                            
                                                                
                                                                    
                                                                        Protein Length
                                                                    
                                                                
                                                                Full length
                                                             
                                                            
                                                            
                                                                
                                                                    
                                                                        Storage
                                                                    
                                                                
                                                                Aliquot and store at -20°C or lower. For long term storage, we recommend to store at -70°C or lower. Avoid freeze/thaw cycles.
                                                             
                                             
                                         
                                     
                                 
                             
                            
                                
                                    Target
                                
                                
                                    
                                        
                                            
                                                            
                                                                
                                                                    
                                                                        Target Protein
                                                                    
                                                                
                                                                GTPV_gp008
                                                             
                                                            
                                                                
                                                                    
                                                                        Full Name
                                                                    
                                                                
                                                                LAP/PHD finger-like protein
                                                             
                                                            
                                                                
                                                                    
                                                                        Alternative Names
                                                                    
                                                                
                                                                GTPV_gp008; LAP/PHD finger-like protein; contains a Ring-CH-type zinc finger which coordinates two zinc atoms; similar to lumpy skin disease virus LSDV10; The poxviridae are enveloped unsegmented dsDNA viruses; unlike many dsDNA viruses that replicate in the host nucleus poxviruses encode their own replication machinery and therefore replicate in the cytoplasm; viral genes are expressed in a bi-phasic manner with early genes encoding non-structural proteins involved in genome replication and late genes encoding the viral structural proteins