Goatpox Virus (Pellor) GTPV_gp141.2 Recombinant Protein(MPYF-1122-KX589)
This product is a made-to-order Goatpox Virus (Pellor) GTPV_gp141.2 recombinant protein. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.
Product Specifications
Target Protein
GTPV_gp141.2
Sequence
MEYISDYEELLKEIYINQSNLKINVLKKIINDIPTTYHKGIYNNLLLTVLGNKIISLSVQKYKKILSFLVDNGADLNTKIKYKYNALHYYLYSNSNVTVDILKFLIKKGADITKKCNGNNVLHTYLCNKNIDFNVIKFLVNKKIDLGNRNLDNHTPVDIYISNKRNNCDIDTLKLLFLVDFNIYNKEDIFLSALDVFLNYLKSYTRKSLDIVNYILENISINSVDSNGFNPILYATVSGQKVFFDYFLKLGCSINITTSCGETCGSLSLMDCDYCTFKTFLSKKPNLQTIENTLSCLSSYLEDIYYCDLKFKMFKELLLEAFMLDSEFYNRHKSIKLYFPKTISLYKEPIVQMCNDKIGDKSVYNIIFKNSDIRYCYNDYINKYTNLKYYGNIIRKYILASKMKKKNIVNIIKTIDISPYWNTLPTEIKMYIINFLSDNEIKLLAIK
Product Description
Expression Systems
Based on specific requirements
Protein Tag
Based on specific requirements
Protein Length
Full length
Storage
Aliquot and store at -20°C or lower. For long term storage, we recommend to store at -70°C or lower. Avoid freeze/thaw cycles.
Target
Target Protein
GTPV_gp141.2
Full Name
ankyrin-like protein
Alternative Names
GTPV_gp141.2; ankyrin-like protein; although the function of the ankyrin-like protein is not completely understood, it is highly conserved throughout the Orthopoxvirus genus; it may be critical for overcoming cellular restriction factors; the ankyrin-like protein of the modified vaccinia virus ankara interacts with Skp1a, a member of the Skp1a-Cullin-1-F-box (SCF) ubiquitin ligase complex; The poxviridae are enveloped unsegmented dsDNA viruses; unlike many dsDNA viruses that replicate in the host nucleus poxviruses encode their own replication machinery and therefore replicate in the cytoplasm; viral genes are expressed in a bi-phasic manner with early genes encoding non-structural proteins involved in genome replication and late genes encoding the viral structural proteins