Goatpox Virus (Pellor) GTPV_gp014 Recombinant Protein(MPYF-1122-KX584)
This product is a made-to-order Goatpox Virus (Pellor) GTPV_gp014 recombinant protein. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.
Product Specifications
Target Protein
GTPV_gp014
Sequence
MDNYNYNIEKVLNVYLRDLRIESLNNNELAILIMIRECCEVIKKDYKTEFNEICNFILHNNVKSCYDINDVKNIIIETINSDFRPSVILASISLLSVIIKKKKNENNEVVNDDLALNELINTFSSYQKDIISFVEKNKKNNKYNDFIFSIINFFVIVGSIIITYYLLKIIGRIRWK
Product Description
Expression Systems
Based on specific requirements
Protein Tag
Based on specific requirements
Protein Length
Full length
Storage
Aliquot and store at -20°C or lower. For long term storage, we recommend to store at -70°C or lower. Avoid freeze/thaw cycles.
Target
Target Protein
GTPV_gp014
Full Name
anti-apoptotic membrane protein
Alternative Names
GTPV_gp014; anti-apoptotic membrane protein; inhibits apoptosis of infected cells; similar to Yaba monkey tumor virus 16L; The poxviridae are enveloped unsegmented dsDNA viruses; unlike many dsDNA viruses that replicate in the host nucleus poxviruses encode their own replication machinery and therefore replicate in the cytoplasm; viral genes are expressed in a bi-phasic manner with early genes genes encoding non-structural proteins involved in genome replication and late genes encoding the viral structural proteins; Members of the genus Yatapoxvirus, which include Tanapox virus (TPV) and Yaba monkey tumor virus, infect primates including humans