Yaba Monkey Tumor Virus (VR587) YMTVg12L Recombinant Protein(MPYF-1122-KX371)
                        
                     
                        This product is a made-to-order Yaba Monkey Tumor Virus (VR587) YMTVg12L recombinant protein. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.
                    
                    
                            
                                
                                    Product Specifications
                                
                                
                                    
                                        
                                            
                                                            
                                                            
                                                                
                                                                    
                                                                        Species
                                                                    
                                                                
                                                                Yaba Monkey Tumor Virus
                                                             
                                                            
                                                            
                                                            
                                                                
                                                                    
                                                                        Sequence
                                                                    
                                                                
                                                                MSRNRSQLAFCYAFPTVGTITKGVVTVEGDSFTVFLPEFGLHALIVNYLSVNVKRAKKLSEKLSGKTVTVQVIRTDKLKGYVDVRHIE
                                                             
                                             
                                         
                                     
                                 
                             
                            
                                
                                    Product Description
                                
                                
                                    
                                        
                                            
                                                            
                                                                
                                                                    
                                                                        Expression Systems
                                                                    
                                                                
                                                                Based on specific requirements
                                                             
                                                            
                                                                
                                                                    
                                                                        Protein Tag
                                                                    
                                                                
                                                                Based on specific requirements
                                                             
                                                            
                                                                
                                                                    
                                                                        Protein Length
                                                                    
                                                                
                                                                Full length
                                                             
                                                            
                                                            
                                                                
                                                                    
                                                                        Storage
                                                                    
                                                                
                                                                Aliquot and store at -20°C or lower. For long term storage, we recommend to store at -70°C or lower. Avoid freeze/thaw cycles.
                                                             
                                             
                                         
                                     
                                 
                             
                            
                                
                                    Target
                                
                                
                                    
                                        
                                            
                                                            
                                                            
                                                                
                                                                    
                                                                        Full Name
                                                                    
                                                                
                                                                EIF2a-like PKR inhibitor
                                                             
                                                            
                                                                
                                                                    
                                                                        Alternative Names
                                                                    
                                                                
                                                                YMTVg12L; EIF2a-like PKR inhibitor; acts to inhibit protein kinase PKR (EIF2AK2) and plays a major role virus resistance to interferon; similar to vaccinia virus Copenhagen K3L; The poxviridae are enveloped unsegmented dsDNA viruses; unlike many dsDNA viruses that replicate in the host nucleus poxviruses encode their own replication machinery and therefore replicate in the cytoplasm; viral genes are expressed in a bi-phasic manner with early genes genes encoding non-structural proteins involved in genome replication and late genes encoding the viral structural proteins