Pseudocowpox Virus (VR634) PCPV_gp025 Recombinant Protein(MPYF-1022-KX550)

This product is a made-to-order Pseudocowpox Virus (VR634) PCPV_gp025 recombinant protein. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications
Target Protein
PCPV_gp025
Species
Pseudocowpox Virus
Strain
VR634
Protein Class
Virology
Sequence
MVDSGRHDVDAAAQERTPNQQTFFTKGLSPLMRHTYIYNNYAYGWIPETALWSSRLGDYRVTDFYPISLGMLKKFEFMFSLLADPGGACPVYEPKLNTEFLDRGSFSGRFVNPFHRFAALPEREYISFLLLSSVPIFNILFWFKGETFDTAKHSLLGAVYTTPERHIELARYLRRTGDYKPLFSRLGNDDTFTKPFSGFTRIGNPTPIGRLPPSDFETIANLSTILYYTRYDPVLCFLVFYVPGLSATTKITPGVEFLMEKLSLAPENVVLL
Product Description
Expression Systems
Based on specific requirements
Protein Tag
Based on specific requirements
Protein Length
Full length
Protein Form
Soluble
Storage
Aliquot and store at -20°C or lower. For long term storage, we recommend to store at -70°C or lower. Avoid freeze/thaw cycles.
Target
Target Protein
PCPV_gp025
Full Name
membrane protein
Alternative Names
PCPV_gp025; membrane protein
Gene ID
UniProt ID

Related Products

We DO NOT PROVIDE ANY PRODUCTS OR SERVICES DIRECTLY TO PATIENTS. All of our products are for Research Use Only (RUO), NOT intended for diagnostic, therapeutic, or clinical use.

Inquiry
Now