Orf Virus (Sore Mouth Infection) (OV-SA00) ORFVgORF094 Recombinant Protein(MPYF-1022-KX398)

This product is a made-to-order Orf Virus (Sore Mouth Infection) (OV-SA00) ORFVgORF094 recombinant protein. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications
Target Protein
ORFVgORF094
Species
Orf Virus (Sore Mouth Infection)
Strain
OV-SA00
Protein Class
Virology
Sequence
MESYFSYYNDEFTAGGVQDAELFSPEEQNAFLPKDPGTADSPLVPATPRPVPGGNIAPYSVLQYEDIRILTGIVIFVLALTSTPVLALVMIGIASLILPLPCLVIGYCAAMQIMHPYAANNTGMAIVCTIMSIVTIIVTHVTGSVGATTFMYIVLGLLFAIYAFRLTGRGIVRTRSAAPACPVYAGAKSEDLFFAE
Product Description
Expression Systems
Based on specific requirements
Protein Tag
Based on specific requirements
Protein Length
Full length
Protein Form
Soluble
Storage
Aliquot and store at -20°C or lower. For long term storage, we recommend to store at -70°C or lower. Avoid freeze/thaw cycles.
Target
Target Protein
ORFVgORF094
Full Name
ORF094 putative phosphorylated IMV membrane protein
Alternative Names
ORFVgORF094; ORF094 putative phosphorylated IMV membrane protein
Gene ID
UniProt ID

Related Products

We DO NOT PROVIDE ANY PRODUCTS OR SERVICES DIRECTLY TO PATIENTS. All of our products are for Research Use Only (RUO), NOT intended for diagnostic, therapeutic, or clinical use.

Inquiry
Now