Magic™ Yaba Monkey Tumor Virus (VR587) YMTVg77R Recombinant Protein(MPYF-1122-KX351)
This product is a made-to-order Yaba Monkey Tumor Virus (VR587) YMTVg77R recombinant protein. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.
Product Specifications
Species
Yaba Monkey Tumor Virus
Sequence
MKGLYYNDGKLFEDKELTMSVSSDNPAYEILKKIKIPSYLTDVVVYEQTYDESLNRLIFVGSDSKGKRQYFYGKLHVKQRNDNRNNIFVNVYGVIDNINRFIDGNITSKKKNDTNFQLAVLMLMETSFFIRMGKMRYLKENKTVGLITLKNENIIVNNDKILIKFTGKDKVVHEFVVYESNRLYNPLLNLVNEKNPNGFLFNKLSEKKVYEFMRKFNIRIKDLRTYGVNYTFLYNFWSNVKSINPLPNTKKLISMTIKQTAEIVGHTPSISKNAYMANTVIDLLQKSDILKTIREIDFNEFMNLVIGYVKNKKII
Product Description
Expression Systems
Based on specific requirements
Protein Tag
Based on specific requirements
Protein Length
Full length
Storage
Aliquot and store at -20°C or lower. For long term storage, we recommend to store at -70°C or lower. Avoid freeze/thaw cycles.
Target
Full Name
DNA topoisomerase type I
Alternative Names
YMTVg77R; DNA topoisomerase type I; ATP-independent enzyme that regulates the number of topological links between two DNA strands; relaxes positively and/or negatively supercoiled DNA