Magic™ Yaba Monkey Tumor Virus (VR587) YMTVg145R Recombinant Protein(MPYF-1122-KX275)

This product is a made-to-order Yaba Monkey Tumor Virus (VR587) YMTVg145R recombinant protein. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications
Target Protein
YMTVg145R
Species
Yaba Monkey Tumor Virus
Strain
VR587
Protein Class
Virology
Sequence
METATVVDNYSCYCSDRECDLKYTSGLRVNYFVMVLYTLLFIFGLVGNVLVITVLIIKRFIFTIDVYLFNIALSDMMLVFSFPFIIHNGLNEMIFGKIVCKLVSGTYFVGFFSNMFFIMLISIDRYISVVNATKIKSKSINLSILLSVSVWVCSIILSSPVMVLYHVDNMYYINHYIMFNGKQKNFSLYTFLNFEINIFSTVILTISMYCYFKMLVTLKSCRNSIRTRPIKIILAVVTFTTVFWIPFNAVLLVNSLYTVGLINISCYHFKKIVCSIHVLELISFFHCCVNPIIYSFVGKNFFRAFKTIFCKVNKINGVNVSLRRSSTIF
Product Description
Expression Systems
Based on specific requirements
Protein Tag
Based on specific requirements
Protein Length
Full length
Protein Form
Soluble
Concentration
Lot specific
Storage
Aliquot and store at -20°C or lower. For long term storage, we recommend to store at -70°C or lower. Avoid freeze/thaw cycles.
Target
Target Protein
YMTVg145R
Full Name
chemokine receptor-like protein
Alternative Names
YMTVg145R; chemokine receptor-like protein; G-protein-coupled receptors constitute a large family of transmembrane proteins that adopt a similar structural framework comprised of 7 transmembrane helices; they typically transduce extracellular signals; poxviruses likely use the G protein-coupled chemokine receptor-like proteins to facilitate immune evasion; The poxviridae are enveloped unsegmented dsDNA viruses; unlike many dsDNA viruses that replicate in the host nucleus poxviruses encode their own replication machinery and therefore replicate in the cytoplasm; viral genes are expressed in a bi-phasic manner with early genes genes encoding non-structural proteins involved in genome replication and late genes encoding the viral structural proteins; Members of the genus Yatapoxvirus, which include Tanapox virus (TPV) and Yaba monkey tumor virus, infect primates including humans
Gene ID
UniProt ID

Related Products

We DO NOT PROVIDE ANY PRODUCTS OR SERVICES DIRECTLY TO PATIENTS. All of our products are for Research Use Only (RUO), NOT intended for diagnostic, therapeutic, or clinical use.