Magic™ Variola (Smallpox) Virus (India-1967, Ind3) P2L Recombinant Protein(MPYF-0922-KX689)

This product is a made-to-order Variola (Smallpox) Virus (India-1967, Ind3) P2L recombinant protein. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications
Target Protein
P2L
Species
Variola (Smallpox) Virus
Strain
India-1967, Ind3
Protein Class
Virology
Sequence
MSSSTMDNNEPKVLEMVYDSPILPEGSSMDPNIINCINRHINMCLQHTYSSSIIAILDRFLMMNKDELNNTQCHIIKEFMTYEQMAIDHYGGYVNAILYQIRKRPNQHHTIDLFKKIKRTRYDTFKVDPVEFVKKVIGFVSILNKYKPVYSYVLYENVLYDELKCFIDYVETKYFQN
Product Description
Expression Systems
Based on specific requirements
Protein Tag
Based on specific requirements
Protein Length
Full length
Protein Form
Soluble
Concentration
Lot specific
Storage
Aliquot and store at -20°C or lower. For long term storage, we recommend to store at -70°C or lower. Avoid freeze/thaw cycles.
Target
Target Protein
P2L
Full Name
putative alpha aminitin-sensitive protein
Alternative Names
P2L; putative alpha aminitin-sensitive protein; VARVgp017
Gene ID
UniProt ID

Related Products

We DO NOT PROVIDE ANY PRODUCTS OR SERVICES DIRECTLY TO PATIENTS. All of our products are for Research Use Only (RUO), NOT intended for diagnostic, therapeutic, or clinical use.