Online Inquiry
We DO NOT PROVIDE ANY PRODUCTS OR SERVICES DIRECTLY TO PATIENTS. All of our products are for Research Use Only (RUO), NOT intended for diagnostic, therapeutic, or clinical use.
Magic™ Sheeppox Virus (TU-V02127) SPPV_37 Recombinant Protein(MPYF-1122-KX441)
DatasheetThis product is a made-to-order Sheeppox Virus (TU-V02127) SPPV_37 recombinant protein. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.
Product Specifications
Target Protein
SPPV_37
Species
Sheeppox Virus
Strain
TU-V02127
Protein Class
Virology
Sequence
MELVNIFLESDCGRVKIEVQNNTNDSECKKSSVVKSTNNFIDIINQYINVEKSTFYLAIKNQDIFIFKYDKGKISQIENEFFTFNSELMFVNNYNKITGIEFIVTDTMSIHIYPKVGLSVISSSNNNKFY
Product Description
Expression Systems
Based on specific requirements
Protein Tag
Based on specific requirements
Protein Length
Full length
Protein Form
Soluble
Storage
Aliquot and store at -20°C or lower. For long term storage, we recommend to store at -70°C or lower. Avoid freeze/thaw cycles.
Target
Target Protein
SPPV_37
Full Name
putative virion core protein
Alternative Names
SPPV_37; putative virion core protein; similar to vaccinia virus strain Copenhagen E11L; The poxviridae are enveloped unsegmented dsDNA viruses; unlike many dsDNA viruses that replicate in the host nucleus poxviruses encode their own replication machinery and therefore replicate in the cytoplasm; viral genes are expressed in a bi-phasic manner with early genes encoding non-structural proteins involved in genome replication and late genes encoding the viral structural proteins
Gene ID
UniProt ID
Related Products
We DO NOT PROVIDE ANY PRODUCTS OR SERVICES DIRECTLY TO PATIENTS. All of our products are for Research Use Only (RUO), NOT intended for diagnostic, therapeutic, or clinical use.