Magic™ Monkeypox virus (Zaire-96-I-16) A28L Recombinant Protein(MPYF-0722-KX241)

This product is a made-to-order Monkeypox virus (Zaire-96-I-16) A28L recombinant protein. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications
Target Protein
A28L
Species
Monkeypox virus
Strain
Zaire-96-I-16
Protein Class
Virology
Sequence
MANIINLWNGIVPTVQDVNVASITAFKSMIDETWDKKIEANTCI
SRKHRNIIHEVIRDFMKAYPKMDENRKSPLGAPMQWLTQYYILKNEYHKTMLAYDDGS
LNTKFKTLNIYMITNVGQYILYIVFCIISGKNHDGTPYIYDSEITSNDKNLINDRIKY
ACKQILHGQLTMALRIRNKFMFIGSPMYLWFNVNGSHVYHEIYDRNVGFHNKEIGRLL
YAFMYYLSISGRFLNDLALLKFTYLGESWTFSLSVPEYILYGLGYSVFDTIEKFSNDA
ILVYIRTNNRNGYDYAEFNKKGIVKVTEDKPDNDKRIHAIRLINYSSDVQHIHFGFRN
TLIIDNECTSIQSSAENATDTGHHQDSKINIEDDDDDIIDDDDDDDDDDDDDDDDDDD
DDDDYNPKPTPIPDPHPRPPFPRHDYHKRPKLLPVEEPDPVKKDADRIRLDNHILNTL
DHNLNSIGHYCCDTVAVDRLEHHIETLGQYTVILARKINMQTLLFPWPLPTVHPHAID
GSIPPHGRSTIL
Product Description
Expression Systems
Based on specific requirements
Protein Tag
Based on specific requirements
Protein Length
Full length
Protein Form
Soluble
Concentration
Lot specific
Storage
Aliquot and store at -20°C or lower. For long term storage, we recommend to store at -70°C or lower. Avoid freeze/thaw cycles.
Target
Target Protein
A28L
Full Name
A28L
Alternative Names
MPXVgp138; A28L; major component of IMV surface tubules; p4c
Gene ID
UniProt ID

Related Products

We DO NOT PROVIDE ANY PRODUCTS OR SERVICES DIRECTLY TO PATIENTS. All of our products are for Research Use Only (RUO), NOT intended for diagnostic, therapeutic, or clinical use.