Online Inquiry
We DO NOT PROVIDE ANY PRODUCTS OR SERVICES DIRECTLY TO PATIENTS. All of our products are for Research Use Only (RUO), NOT intended for diagnostic, therapeutic, or clinical use.
Magic™ Goatpox Virus (Pellor) GTPV_gp011 Recombinant Protein(MPYF-1122-KX579)
DatasheetThis product is a made-to-order Goatpox Virus (Pellor) GTPV_gp011 recombinant protein. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.
Product Specifications
Target Protein
GTPV_gp011
Species
Goatpox Virus
Strain
Pellor
Protein Class
Virology
Sequence
MSSNSDLAFCYVLPNINEVTDGIVFIKDNIVYVKLINYGLEALVIDYVDINMDQMNNIKKTLVNKLINVQIVRMNKIKGYIDVKVHNNN
Product Description
Expression Systems
Based on specific requirements
Protein Tag
Based on specific requirements
Protein Length
Full length
Protein Form
Soluble
Concentration
Lot specific
Storage
Aliquot and store at -20°C or lower. For long term storage, we recommend to store at -70°C or lower. Avoid freeze/thaw cycles.
Target
Target Protein
GTPV_gp011
Full Name
EIF2a-like PKR inhibitor
Alternative Names
GTPV_gp011; EIF2a-like PKR inhibitor; acts to inhibit protein kinase PKR (EIF2AK2) and plays a major role virus resistance to interferon; similar to vaccinia virus Copenhagen K3L; The poxviridae are enveloped unsegmented dsDNA viruses; unlike many dsDNA viruses that replicate in the host nucleus poxviruses encode their own replication machinery and therefore replicate in the cytoplasm; viral genes are expressed in a bi-phasic manner with early genes genes encoding non-structural proteins involved in genome replication and late genes encoding the viral structural proteins
Gene ID
UniProt ID
Related Products
We DO NOT PROVIDE ANY PRODUCTS OR SERVICES DIRECTLY TO PATIENTS. All of our products are for Research Use Only (RUO), NOT intended for diagnostic, therapeutic, or clinical use.