Magic™ Fowlpox Virus (NVSL) FPV205 Recombinant Protein(MPYF-1222-KX819)

This product is a made-to-order Fowlpox Virus (NVSL) FPV205 recombinant protein. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications
Target Protein
FPV205
Species
Fowlpox Virus
Strain
NVSL
Protein Class
Virology
Sequence
MNRVIRILVILSNVVHVYPCKRSVSIEQSEANIILCPSTSIKCVKWMYVEKKEPKSQIYKTLGIMVFPDSYHIKEPNYLSNLTLDKITLKRWSTGDVYHVSIGIKKKCMGSVIESIFVDDSYITRRDNYNSTELYNNTTNIVLVHFLNNYQLYTLVLSSICVVIIIIIVCYISYKHKYINKKIKTISNSEKFILINVHPDREPLITHIDESEYESDDN
Product Description
Expression Systems
Based on specific requirements
Protein Tag
Based on specific requirements
Protein Length
Full length
Protein Form
Soluble
Storage
Aliquot and store at -20°C or lower. For long term storage, we recommend to store at -70°C or lower. Avoid freeze/thaw cycles.
Target
Target Protein
FPV205
Full Name
hypothetical protein
Alternative Names
FPV205; hypothetical protein; similar to Fowlpox virus FPV207; The poxviridae are enveloped unsegmented dsDNA viruses; unlike many dsDNA viruses that replicate in the host nucleus poxviruses encode their own replication machinery and therefore replicate in the cytoplasm; viral genes are expressed in a bi-phasic manner with early genes encoding non-structural proteins involved in genome replication and late genes encoding the viral structural proteins; canarypox and fowlpox are members of the Avipoxvirus genus and infect nonmammalian hosts; Fowlpox virus infects chickens and turkeys while Canarypox has a broader host-range and infects passeriform (song) birds.
Gene ID
UniProt ID

Related Products

We DO NOT PROVIDE ANY PRODUCTS OR SERVICES DIRECTLY TO PATIENTS. All of our products are for Research Use Only (RUO), NOT intended for diagnostic, therapeutic, or clinical use.