Magic™ Camelpox virus (M-96) CamMLVgp155 Recombinant Protein(MPYF-0722-KX314)

This product is a made-to-order Camelpox virus (M-96) CamMLVgp155 recombinant protein. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications
Target Protein
CamMLVgp155
Species
Camelpox virus
Strain
M-96
Protein Class
Virology
Sequence
MMLVPLIMVTVVAGTILVCYILYICRKKIRTVYNDNKIIMTKLKKIKSSNSSKSSKSTDSESDWEDHCSAMEQNNDMDNISRNEILDDDSFAGSLIWDNESNVMAPSTEHIYDSVAGSTLLINNDRNEQTIYHNTTVINETETIEVLNEDTKQNHSYSSNPFVNYNKTSICSKSNPFITELNNKFSENNPFRRAHSDDYLNNQEQEHDDIESSVMSYH
Product Description
Expression Systems
Based on specific requirements
Protein Tag
Based on specific requirements
Protein Length
Full length
Protein Form
Soluble
Concentration
Lot specific
Storage
Aliquot and store at -20°C or lower. For long term storage, we recommend to store at -70°C or lower. Avoid freeze/thaw cycles.
Target
Target Protein
CamMLVgp155
Full Name
CMLV155
Alternative Names
CamMLVgp155; CMLV155; putative EEV protein; similar to vaccinia virus strain Copenhagen A36R, variola major virus strain Bangladesh A38R
Gene ID
UniProt ID

Related Products

We DO NOT PROVIDE ANY PRODUCTS OR SERVICES DIRECTLY TO PATIENTS. All of our products are for Research Use Only (RUO), NOT intended for diagnostic, therapeutic, or clinical use.