Online Inquiry
We DO NOT PROVIDE ANY PRODUCTS OR SERVICES DIRECTLY TO PATIENTS. All of our products are for Research Use Only (RUO), NOT intended for diagnostic, therapeutic, or clinical use.
Magic™ Camelpox virus (M-96) CamMLVgp059 Recombinant Protein(MPYF-0722-KX436)
DatasheetThis product is a made-to-order Camelpox virus (M-96) CamMLVgp059 recombinant protein. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.
Product Specifications
Target Protein
CamMLVgp059
Species
Camelpox virus
Strain
M-96
Protein Class
Virology
Sequence
MGTVATIPTPTKLMNKENVEMILEKIVDHIVMYISDESRDENNPEYIDFRNRYGDYRSLIIKSDHEFIKLCKYHAEKSSPETQQMIIKHIYEQYLIPVSEVLLKPMMSMGDIITYNGCKDNEWMLEHLSTLNFNNLHVWNSCSIGNVMRIFYTFFSYLMKDKLDI
Product Description
Expression Systems
Based on specific requirements
Protein Tag
Based on specific requirements
Protein Length
Full length
Protein Form
Soluble
Concentration
Lot specific
Storage
Aliquot and store at -20°C or lower. For long term storage, we recommend to store at -70°C or lower. Avoid freeze/thaw cycles.
Target
Target Protein
CamMLVgp059
Full Name
Putative myristoylated protein
Alternative Names
CamMLVgp059; putative myristoylated protein; protein is likely myristolated; myristoylation is the co-translational modification of a protein with myristic acid, a fatty acid; The poxviridae are enveloped unsegmented dsDNA viruses; unlike many dsDNA viruses that replicate in the host nucleus poxviruses encode their own replication machinery and therefore replicate in the cytoplasm; viral genes are expressed in a bi-phasic manner with early genes encoding non-structural proteins involved in genome replication and late genes encoding the viral structural proteins; the Entomopoxvirinae are a sub-family of the Poxviridae that infect insects
Gene ID
UniProt ID
Related Products
We DO NOT PROVIDE ANY PRODUCTS OR SERVICES DIRECTLY TO PATIENTS. All of our products are for Research Use Only (RUO), NOT intended for diagnostic, therapeutic, or clinical use.