Magic™ Camelpox virus (M-96) CamMLVgp023 Recombinant Protein(MPYF-0722-KX336)
This product is a made-to-order Camelpox virus (M-96) CamMLVgp023 recombinant protein. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.
Product Specifications
Target Protein
CamMLVgp023
Sequence
MKVESVTFLTLLGIVCVLSCCTIPSRPINMKFKNSVETYANTNTNYNIGDTIEYLCLPGYRKQKMGPIYAKCTGTGWTLFNQCIKRRCPSPRDIDNGQLDIGGVDFGSSITYSCNSGYHLIGESKSYCELGSTGSMVWNPEAPICESVKCQSPPSISNGRHNGYDNFYTDGSVVTYSCNSGYSLIGNSGVLCSGGEWSDPPTCQIVKCPHPTISNGYLSSGFKRSYSYNDNVDFTCKYGYKLSGSSSSTCSPGNTWQPELPKCVR
Product Description
Expression Systems
Based on specific requirements
Protein Tag
Based on specific requirements
Protein Length
Full length
Storage
Aliquot and store at -20°C or lower. For long term storage, we recommend to store at -70°C or lower. Avoid freeze/thaw cycles.
Target
Target Protein
CamMLVgp023
Full Name
Secreted complement-binding protein
Alternative Names
CamMLVgp023; secreted complement-binding protein; binds host complement components C3b and C4b to modulate the host inflammatory response; blocks both classical and alternative pathways of complement activity; similar to Vaccinia virus Copenhagen C3L; the poxviridae are enveloped unsegmented dsDNA viruses; unlike many dsDNA viruses that replicate in the host nucleus poxviruses encode their own replication machinery and therefore replicate in the cytoplasm; viral genes are expressed in a bi-phasic manner with early genes genes encoding non-structural proteins involved in genome replication and late genes encoding the viral structural proteins
Datasheet