Magic™ Bovine Papular Stomatitis Virus (BV-AR02) BPSVgORF076 Recombinant Protein(MPYF-1022-KX229)
This product is a made-to-order Bovine Papular Stomatitis Virus (BV-AR02) BPSVgORF076 recombinant protein. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.
Product Specifications
Target Protein
BPSVgORF076
Species
Bovine Papular Stomatitis Virus
Sequence
MKRIALCRVDISAPRASACPPPAAGRIEYVLPKYFNSVSSDRLALRAADGSCWFCKQRVGAAPLAVETLDGAAIGEFCSRLCRDSFAGLVKHLVALREEPKIELLPLEMYADPDRVRALINETRELDGVYGRCYVERDGRAARMALKSLI
Product Description
Expression Systems
Based on specific requirements
Protein Tag
Based on specific requirements
Protein Length
Full length
Storage
Aliquot and store at -20°C or lower. For long term storage, we recommend to store at -70°C or lower. Avoid freeze/thaw cycles.
Target
Target Protein
BPSVgORF076
Full Name
late transcription factor VLTF-2
Alternative Names
BPSVgORF076; late transcription factor VLTF-2; acts with RNA polymerase to initiate transcription from late gene promoters; has zinc-finger motifs; The poxviridae are enveloped unsegmented dsDNA viruses; unlike many dsDNA viruses that replicate in the host nucleus poxviruses encode their own replication machinery and therefore replicate in the cytoplasm; viral genes are expressed in a bi-phasic manner with early genes encoding non-structural proteins involved in genome replication and late genes encoding the viral structural proteins
Datasheet