Magic™ Bovine Papular Stomatitis Virus (BV-AR02) BPSVgORF016 Recombinant Protein(MPYF-1022-KX313)

This product is a made-to-order Bovine Papular Stomatitis Virus (BV-AR02) BPSVgORF016 recombinant protein. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications
Target Protein
BPSVgORF016
Species
Bovine Papular Stomatitis Virus
Strain
BV-AR02
Protein Class
Virology
Sequence
MDESDEISRRMAMIITTSRMQSMGDTIRQEEICRQFCSKHGMFPAVTVRVTGVVSADAIGQDTWDLARSHDVRHVVLFKASVVDWRIAELFLEFGDKLCEIYTLSFVVDGFHYDGSASPFKPVDGMETMLRCVLRDVLDDAGGGAVVPRAPSVASQCLLDRYLVPFGGLLAMYNHFTGVHSQVPSARLEASRGRSVRRAIFHGYADTETYNQMLAEARRHNVRRRRRQDRFDLLAVCRSLDCMTLDGDE
Product Description
Expression Systems
Based on specific requirements
Protein Tag
Based on specific requirements
Protein Length
Full length
Protein Form
Soluble
Storage
Aliquot and store at -20°C or lower. For long term storage, we recommend to store at -70°C or lower. Avoid freeze/thaw cycles.
Target
Target Protein
BPSVgORF016
Full Name
hypothetical protein
Alternative Names
BPSVgORF016; ORF016 hypothetical protein; unknown function; Similar to Vaccinia virus strain Copenhagen F16L and Molluscum contagiosum virus MC029L; Viruses of the genus parapoxvirus cause localized diseases in large and small ruminants; the poxviridae are enveloped unsegmented dsDNA viruses; unlike many dsDNA viruses that replicate in the host nucleus poxviruses encode their own replication machinery and therefore replicate in the cytoplasm; viral genes are expressed in a bi-phasic manner with early genes genes encoding non-structural proteins involved in genome replication and late genes encoding the viral structural proteins; Orf virus and BPSV are capable of infecting humans but usually infect sheep, goats and cattle
Gene ID
UniProt ID

Related Products

We DO NOT PROVIDE ANY PRODUCTS OR SERVICES DIRECTLY TO PATIENTS. All of our products are for Research Use Only (RUO), NOT intended for diagnostic, therapeutic, or clinical use.