Canarypox Virus (VR-111) CNPV296 Recombinant Protein(MPYF-1222-KX644)
This product is a made-to-order Canarypox Virus (VR-111) CNPV296 recombinant protein. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.
Product Specifications
Sequence
MKNKYFIEDLSRSYITMLFNAIKNCDCQKVIDLIRSSNIDVNIIEENLRLSPLHYAVECGNKDIVITILEHGGDVNLHVGDIQTPIDIAVNACNLDMVKLLVENGADIDTCIDCEYHYTPLQNAINNNSYEITEFLLLSGADTDENYTSLYPLMFAIRNGNKEIVKLLLEYNASTDKIEYGEGYPINLAIRYGNIEIVDELLRHGANPNSSYRYSSCLKIPLHQAVYYHRAEIVKLLILYGADVDSKDSNGNTPMHLAVNEVQEDIIRTLLDSWANVTIINESLSTCLLGCYTTATFPISIKEMLISRTVLYKYINEDISINGLLFNWLIIESDEYSDQYKTECEKEISSMISYKIGSKCLFDVCFGKVNYKQLIRYLMNNEYCINEYKIYKEMLEKNILIAKERNTLIQDSLSKIDNLIDNKVLSVNNRWSALPVELKHMILCYLSNDDLKLIVDSK
Product Description
Expression Systems
Based on specific requirements
Protein Tag
Based on specific requirements
Protein Length
Full length
Storage
Aliquot and store at -20°C or lower. For long term storage, we recommend to store at -70°C or lower. Avoid freeze/thaw cycles.
Target
Full Name
CNPV296 ankyrin repeat protein
Alternative Names
CNPV296; CNPV296 ankyrin repeat protein